PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_19630g0030
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family ZF-HD
Protein Properties Length: 216aa    MW: 22962.7 Da    PI: 6.7369
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_19630g0030genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer107.29.9e-3473129259
    ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                    ++vrY+eClkNhAas+Ggha+DGCg+fmps ge+g+ +alkCaAC+CHRnFHRreve 
  MA_19630g0030  73 KSVRYRECLKNHAASIGGHAIDGCGDFMPS-GEDGSLEALKCAACNCHRNFHRREVEG 129
                    679**************************9.999*********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257741.0E-2275130IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047706.5E-3175127IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015665.8E-3176127IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152328.06877126IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MELGEHDGDM GVMALPMLYG GPAPNIHESS KLKPGENGTA GTGTPSDETR PSDHELLQHE  60
HHHHQQTVAP AKKSVRYREC LKNHAASIGG HAIDGCGDFM PSGEDGSLEA LKCAACNCHR  120
NFHRREVEGE PPCYYCYSPR SCGGRKRGAG PPMALLGPPA QQQHPINATP LALPPTSAHM  180
VARSLLQGAG DNDQDGSSSM RCCREPATTI KTEAAA
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0D6R1643e-64A0A0D6R164_ARACU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9116237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02540.16e-31homeobox protein 21